interferon gamma


Interferon-gamma (IFN-Ξ³) is a dimerized soluble cytokine that is the only member of the type II class of interferons. This interferon was originally called ...


10 Aug 2010 ... >sp|P01579|IFNG_HUMAN Interferon gamma OS=Homo sapiens GN=IFNG PE=1 SV=1 MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK ...


The following medications contain Interferon Gamma-1b: ... Not if your child has an allergy to interferon gamma-1b, E. coli derived proteins, ...


IFN-gamma is produced mainly by T-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing ...


by G Raghu - 2004 - Cited by 318 - Related articles

Anti-Infective Applications of Interferon-Gamma
This reference spotlights the immunologic aspects of applying interferon-gamma to the treatment of infectious diseases - revealing the current knowledge of the biology and potential utility of interferon-gamma.;Written by more than 30 leading ...
5.85 usd

Anti-Infective Applications of Interferon-Gamma
This reference spotlights the immunologic aspects of applying interferon-gamma to the treatment of infectious diseases - revealing the current knowledge of the biology and potential utility of interferon-gamma.;Written by more than 30 leading ...
3.99 usd

Anti-infective Applications Of Interferon-gamma (hardcover, 1992)
This reference spotlights the immunologic aspects of applying interferon-gamma to the treatment of infectious diseases - revealing the current knowledge of the biology and potential utility of interferon-gamma.;Written by more than 30 leading ...
29.35 usd

Anti-infective Applications Of Interferon-gamma (hardcover, 1992)
This reference spotlights the immunologic aspects of applying interferon-gamma to the treatment of infectious diseases - revealing the current knowledge of the biology and potential utility of interferon-gamma.;Written by more than 30 leading ...
13.95 usd

Anti-infective Applications Of Interferon-gamma (hardcover, 1992)
This reference spotlights the immunologic aspects of applying interferon-gamma to the treatment of infectious diseases - revealing the current knowledge of the biology and potential utility of interferon-gamma.;Written by more than 30 leading ...
66.25 usd

interferon gamma 1b, interferon gamma release assay, interferon gamma receptor, interferon gamma therapy, interferon gamma function, interferon gamma blood test, interferon gamma actimmune, interferon gamma side effects, recombinant interferon gamma, interferon gamma treatment,